PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cla015239
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Citrullus
Family MYB_related
Protein Properties Length: 91aa    MW: 10522.2 Da    PI: 10.4563
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cla015239genomeICuGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.25.9e-161663148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W++eEde+l ++    G g+W+ Iar  g+ R++k+c++rw +yl
        Cla015239 16 KGLWSPEEDEKLMRYMLSNGQGCWTDIARNAGLLRCGKSCRLRWINYL 63
                     678*****************************99************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129422.9281167IPR017930Myb domain
Gene3DG3DSA:1.10.10.607.5E-231166IPR009057Homeodomain-like
SMARTSM007171.7E-111565IPR001005SANT/Myb domain
PfamPF002491.1E-141663IPR001005SANT/Myb domain
SuperFamilySSF466897.85E-221890IPR009057Homeodomain-like
CDDcd001671.62E-91963No hitNo description
PROSITE profilePS500903.886491IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.601.6E-86790IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 91 aa     Download sequence    Send to blast
MRKPADSTAA NIRLRKGLWS PEEDEKLMRY MLSNGQGCWT DIARNAGLLR CGKSCRLRWI  60
NYLRPDLKRG AFSPQEEQLI LHLHSLLGNR V
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C3e-15119022100MYB TRANSFORMING PROTEIN
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818044e-95LN681804.1 Cucumis melo genomic scaffold, anchoredscaffold00060.
GenBankLN7132554e-95LN713255.1 Cucumis melo genomic chromosome, chr_1.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008461287.19e-57PREDICTED: transcription factor MYB46-like
SwissprotQ9LXV21e-47MYB46_ARATH; Transcription factor MYB46
TrEMBLA0A0S3SG562e-50A0A0S3SG56_PHAAN; Uncharacterized protein
STRINGPOPTR_0009s06630.17e-48(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF77434128
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G08500.12e-49myb domain protein 83